PENINGKATAN KEMAMPUAN BAHASA ANAK USIA DINI MELALUI KARYAWISATA

M. Arif Syarif H(1*),


(1) 
(*) Corresponding Author

Abstract


ABSTRAK

 

Salah satucara agar tujuanpembelajarantercapaiadalahpenggunaanmetode yang tepat, danjugapenggunaan media di dalamsetiappembelajaran, sehinggadapatmemberikanpengaruhpositifterhadap proses kegiatanbelajarmengajar.Penelitianinibertujuanuntukmengetahuikemampuanberbahasaanakmelaluipenggunaanmetodekaryawisata di TK Al-islahBobosDukupuntang Kabupaten Cirebon dapatmelibatkansiswasecaraaktif, dandapatmeningkatkankerjasiswasehinggadenganpenerapanpenggunaan media karyawisatainidiharapkandapatmeningkatkankemampuanbahasaanakTK Al-islahBobosDukupuntangKabupaten Cirebon. Selamainibanyakparapendidik yang masihmenerapkanmetode yang sifatnyamonotonseperticeramah, danhaltersebutkurangefektifdalammengaktifkansiswadalammengikutikegiatanbelajarmengajar.Hal yang lebihpentinglagiadalahsiswakurangbergairahdanmerasatertekanterhadappembelajaran guru yang selalumenerapkanmetodetersebut, sehinggaimbasnyaadalahkepadakemampuanbahasaanak yang masihrendah.Penelitianinimerupakanpenelitiantindakankelasuntukmemperbaikiataumeningkatkankemampuanbahasadalammengatasikesulitansiswadalampembelajaran, subyekpenelitianiniadalahsiswa kelompok ATK Al-islahBobosDukupuntangKabupaten Cirebon.HasilPenelitianmenunjukkanbahwapenggunaan media karyawisatamemberikanbanyakkontribusidiantaranyamudahnyasiswamemahamimaterimelalui media danpenugasan, siswasemakinaktifdalamkegiatanpembelajaran, siswaterlatihbekerjasamadalamkelompoksertadapatmeningkatkanhasilbelajarsiswapadakemampuanbahasa.Hal inidapatdibuktikandarihasilbelajarkemampuanbahasaanakdiperolehhasil pre tespeningkatanprestasibelajar yang padaawalnya rata-rata 23.5% danpadasiklus I sebesar 52.9% atauterjadipeningkatan 29.4%.Padasiklus II hasilobservasimenunjukkanpeningkatansebesar 53 % ataupeningkatanterjadi 76.5%.PadaSiklus III hasilobservasimenunjukkanpeningkatansebesar 70.6% ataupeningkatanterjadi 94.1%.

 

Kata kunci: Media Karyawisata, KemampuanBahasa


Full Text:

PDF

References


DAFTAR PUSTAKA

Ahmad, Mudzakir. (2007). Psikologi Pendidikan. Bandung : Pustaka Setia.

Goleman, Daniel. (2002). Emitional Intelligence (terjemahan). Jakata : PT Gramedia Pustaka Utama.

Goleman, Daniel. (2000). Working With Emotional Intelligence (terjemahan). Jakarta : PT. Gramedia Pustaka Utama.

Gottman, John. (2001). Kiat-kiat Membesarkan Anak yang Memiliki Kecerdasan Emosional (terjemahan). Jakarta : PT Gramedia Pustaka Utama.

Irwanto. (2007). Psikologi Umum. Jakarta : PT. Gramedia Pustaka Utama.

Jalaludin Rahmat.(2002).Psikologi Komunikasi. Edisi revisi. Bandung: PT. Remaja Rosdakarya.

Mila Ratnawati. (2006). Hubungan antara Persepsi Anak terhadap Suasana Keluarga, Citra Diri, dan Motif Berprestasi dengan Prestasi Belajar pada Siswa Kelas V SD Ta’Miriyah Surabaya. Jurnal Anima Vol XI No. 42.

Moch, Nazir. (2008). Metodologi Penelitian.Cetakan 3. Jakarta :Ghalia Indonesia.

Morgan, Clifford T, King, R.A Weizz, JR, Schopler. J, (2006). Introduction of Psychology, (7th ed), Singapore : Mc Graw Hil Book Company

Muhibbin, Syah. (2000). Psikologi Pendidikan dengan Suatu Pendekatan baru. Bandung : PT. Remaja Rosdakarya.

Nana, Sudjana. (2001). Penilaian Hasil Proses Belajar Mengajar. Cetakan ketujuh. Bandung : PT Remaja Rosdakarya.

Ratna Wilis, D. (2006). Teori-Teori Belajar. Jakarta : Penerbit Erlannga.

Saphiro, Lawrence E. (2008). Mengajarkan Emotional Intelligence Pada Anak. Jakarta : Gramedia.

Sarlito Wirawan. (2007). Psikologi Remaja. Jakarta : PT. RajaGrafindo Persada.




DOI: 10.24235/awlady.v2i2.819

Article Metrics

Abstract view : 530 times
PDF - 598 times

Refbacks

  • There are currently no refbacks.


Awlady: Jurnal Pendidikan Anak, Indexed By:

50  

 

 

 

 

 

Creative Commons License

This work is licensed under a Creative Commons Attribution 4.0 International License.